Protein Info for EX28DRAFT_3141 in Enterobacter asburiae PDN3

Annotation: transcriptional regulator, XRE family with cupin sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF13560: HTH_31" amino acids 23 to 79 (57 residues), 30.5 bits, see alignment E=9.4e-11 PF12844: HTH_19" amino acids 24 to 78 (55 residues), 34 bits, see alignment E=6e-12 PF13443: HTH_26" amino acids 25 to 82 (58 residues), 28.2 bits, see alignment E=4.6e-10 PF01381: HTH_3" amino acids 26 to 79 (54 residues), 46.7 bits, see alignment E=6.7e-16 PF07883: Cupin_2" amino acids 126 to 193 (68 residues), 45.2 bits, see alignment E=1.6e-15

Best Hits

KEGG orthology group: None (inferred from 94% identity to enc:ECL_04459)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>EX28DRAFT_3141 transcriptional regulator, XRE family with cupin sensor (Enterobacter asburiae PDN3)
MTDKVNIMTDSGADVAQVSLAVANRIRNWRKEKKLSLDELSRRASVSKGMLVEIEKGAAN
PSIAILCKLAAALGISVADIVNVSSEPLVHVIEETAIPVLWQGAQGGCARLLAGTAGPDM
IELWQWEMQPGERFTSPGHPAGTFELLHVNEGVLTLTVDETVTQVAAGESAVAKTEAAHG
YANEGKNVLRFTMTVAEFHR