Protein Info for EX28DRAFT_3108 in Enterobacter asburiae PDN3

Annotation: phage tail tape measure protein, TP901 family, core region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 759 transmembrane" amino acids 482 to 504 (23 residues), see Phobius details amino acids 510 to 533 (24 residues), see Phobius details amino acids 538 to 559 (22 residues), see Phobius details amino acids 566 to 591 (26 residues), see Phobius details TIGR01760: phage tail tape measure protein, TP901 family, core region" amino acids 207 to 390 (184 residues), 113.4 bits, see alignment E=5.9e-37 amino acids 387 to 488 (102 residues), 49.2 bits, see alignment E=1.9e-17 PF10145: PhageMin_Tail" amino acids 239 to 394 (156 residues), 96.1 bits, see alignment E=1.3e-31

Best Hits

Predicted SEED Role

"corresponds to STY4603 from Accession AL513382: Salmonella typhi CT18"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (759 amino acids)

>EX28DRAFT_3108 phage tail tape measure protein, TP901 family, core region (Enterobacter asburiae PDN3)
MSNNVSLQELLKAVDRATRPLNALQNASLTLASDIRDAQTALGALDEQAGRINGFRKANA
RLASTEQSLAQAKQQVAALAVQFKSTQNPSQAQADALTAARKSAADLKLEYNSLRYSLQR
QRAELAQAGVNTRTLSSDERRLRTHISEKTQQLNRQRDALARVNQQQERLSTVQNRYESG
KRVTARVSQLANAGVGMAKAGFDQTSRFMAPGISFEKQMSAIQANLGLAKGDSRLEAIRQ
QAREVSARTGVPADTVLRAQTELTRSGYDADGLLAATAPTVNLSLAGSVDAAKAADMIAS
TQAAYSLADTDAGRIADVLTRGSTSSNISLAEMVAAVTAAAPAADAAGMGLEETTALLGV
LAEKGMKGATAGDALSAMLRHVQTPDAIKAAGALASAAGDGSLDEKRQQLQGAKGSTAIA
ASVQTDNLDGDINRFQAAWSGLKIDVFDKADGALRNLITTATGWLGTASLWVNANPELTQ
TLASIVVCAQAFAGVLGGVGTVIGPVLTGVNMVVTAAGMLGTVFSVVGGAIMTVLGALSW
PVIALGAAIAAGALLIFKYWEPISAFFGGVMEGLSTAFAPLGALFSPVMAVFDSISEKLG
GIWQWFTDLITPIKATQETLDGCKNAGVIFGQALGDALMAPLDLFNSLSGKASWLLEKLG
IIKNESGDLDAAAAKAEAASSPAGSAYIPGAGISGGSLGYQPTIATGGRSYVDQSKSEYN
ITLQGGTASGMDLTRQIRETIDNIEQDKARRQQSSFMYS