Protein Info for EX28DRAFT_3098 in Enterobacter asburiae PDN3

Annotation: urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 8 to 203 (196 residues), 334.6 bits, E=1e-104
• PF02492: cobW
  • amino acids 10 to 179 (170 residues), 147.5 bits, E=1.7e-47

Best Hits

Swiss-Prot: 95% identical to UREG_CITK8: Urease accessory protein UreG (ureG) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K03189, urease accessory protein (inferred from 98% identity to enc:ECL_04393)

MetaCyc: 65% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (2/8 steps found)

Protein Sequence (205 amino acids)

>EX28DRAFT_3098 urease accessory protein UreG (Enterobacter asburiae PDN3)
MADYKHPLRVGVGGPVGSGKTALLEALCKAMRDTYHLAVVTNDIYTKEDQRILTEAGALE
PERIVGVETGGCPHTAIREDASMNLVAVEALSENFGNLDLIFVESGGDNLSATFSPELAD
LTIYVIDVAEGEKIPRKGGPGITKSDFLVINKTDLAPYVGASLEVMERDTNRMRGDRPWT
FTNLKAGDGLATIIAFLEEKGMLRV