Protein Info for EX28DRAFT_3095 in Enterobacter asburiae PDN3

Annotation: Urease accessory protein UreE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF02814: UreE_N" amino acids 16 to 62 (47 residues), 53.2 bits, see alignment E=1.7e-18 PF05194: UreE_C" amino acids 72 to 154 (83 residues), 108 bits, see alignment E=2.3e-35

Best Hits

Swiss-Prot: 90% identical to UREE_ENT38: Urease accessory protein UreE (ureE) from Enterobacter sp. (strain 638)

KEGG orthology group: K03187, urease accessory protein (inferred from 94% identity to enc:ECL_04390)

Predicted SEED Role

"Urease accessory protein UreE" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>EX28DRAFT_3095 Urease accessory protein UreE (Enterobacter asburiae PDN3)
MIYLTQRLDHAHPITASVTLPIDVRVKSRARVSLNDGREAGLMLPRGLLLRGGDLLTTDD
GSEVIEVIAAPESVSVVRCADPFLLARACYHLGNRHVPLQIMPGELRYHHDHVLDDMLRQ
FGLEVAYASLPFEPEAGAYTSDAHSHSHSHAHSH