Protein Info for EX28DRAFT_3093 in Enterobacter asburiae PDN3

Annotation: urease, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 TIGR00192: urease, beta subunit" amino acids 1 to 101 (101 residues), 153.2 bits, see alignment E=1e-49 PF00699: Urease_beta" amino acids 3 to 99 (97 residues), 150 bits, see alignment E=8.1e-49

Best Hits

Swiss-Prot: 84% identical to URE2_ENT38: Urease subunit beta (ureB) from Enterobacter sp. (strain 638)

KEGG orthology group: K01429, urease subunit beta [EC: 3.5.1.5] (inferred from 89% identity to enc:ECL_04388)

MetaCyc: 62% identical to urease beta subunit (Sinorhizobium meliloti Rm2011)
Urease. [EC: 3.5.1.5]

Predicted SEED Role

"Urease beta subunit (EC 3.5.1.5)" in subsystem Urea decomposition (EC 3.5.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.5

Use Curated BLAST to search for 3.5.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (104 amino acids)

>EX28DRAFT_3093 urease, beta subunit (Enterobacter asburiae PDN3)
MIPGEYQIQPGTIALNVGRETQSVVVENHGDRPIQVGSHYHFYEVNPALKFDREATKGFR
LNIPAGTAVRFEPGQKREVTLVQITGAQRIFGFRGEVMGEVKHG