Protein Info for EX28DRAFT_3089 in Enterobacter asburiae PDN3

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF01047: MarR" amino acids 35 to 91 (57 residues), 47.1 bits, see alignment E=1.8e-16 PF12802: MarR_2" amino acids 35 to 91 (57 residues), 31.8 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 35% identical to SARZ_STAS1: HTH-type transcriptional regulator SarZ (sarZ) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: None (inferred from 73% identity to pct:PC1_0840)

Predicted SEED Role

"transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>EX28DRAFT_3089 Transcriptional regulators (Enterobacter asburiae PDN3)
MKENKTLDDLLCFSLYSVTNAFVRQYRPLLQEMELTYPQFVVLMALYEKDDIPLRDLSDK
TFFDSGTLTPLVQKLEAKGFLNRIAVVGDERMKNVVLTDKAKDLKKRVMALPDQMRCSMR
MNDDELETLKKLSRTLLDDL