Protein Info for EX28DRAFT_3078 in Enterobacter asburiae PDN3

Annotation: 3,4-dihydroxy-2-butanone 4-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase
  • amino acids 14 to 209 (196 residues), 278.2 bits, E=1.7e-87
• PF00926: DHBP_synthase
  • amino acids 17 to 208 (192 residues), 277.3 bits, E=2.7e-87

Best Hits

Swiss-Prot: 97% identical to RIBB_ENT38: 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB) from Enterobacter sp. (strain 638)

KEGG orthology group: K02858, 3,4-dihydroxy 2-butanone 4-phosphate synthase [EC: 4.1.99.12] (inferred from 97% identity to ent:Ent638_3453)

MetaCyc: 91% identical to 3,4-dihydroxy-2-butanone-4-phosphate synthase (Escherichia coli K-12 substr. MG1655)
3,4-dihydroxy-2-butanone-4-phosphate synthase. [EC: 4.1.99.12]

Predicted SEED Role

"3,4-dihydroxy-2-butanone 4-phosphate synthase (EC 4.1.99.12)" (EC 4.1.99.12)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.12

Protein Sequence (217 amino acids)

>EX28DRAFT_3078 3,4-dihydroxy-2-butanone 4-phosphate synthase (Enterobacter asburiae PDN3)
MNQTLLSSFGTSTQRVEHALDALREGRGVMVLDDENRENEGDMIFAAENMTVEQMALTIR
HGSGIVCLCINEDRRKQLDLPMMVENNTSAFGTGFTVTIEAAHGVTTGVSAADRLTTVRA
AIADGAKPSDLHRPGHVFPLRAQAGGVLTRGGHTEATIDLVTLAGFKPAGVLCELTNDDG
TMARAPECITFARLHNMPVVTIEDLVEYRQAHERKAS