Protein Info for EX28DRAFT_3077 in Enterobacter asburiae PDN3

Annotation: Predicted divalent heavy-metal cations transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 65 to 81 (17 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details PF02535: Zip" amino acids 6 to 91 (86 residues), 39.3 bits, see alignment E=2.4e-14 amino acids 104 to 246 (143 residues), 90.9 bits, see alignment E=4.8e-30

Best Hits

Swiss-Prot: 91% identical to ZUPT_ECO8A: Zinc transporter ZupT (zupT) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 97% identity to enc:ECL_04367)

MetaCyc: 91% identical to divalent metal ion transporter ZupT (Escherichia coli K-12 substr. MG1655)
RXN0-10; RXN0-12; RXN0-16; TRANS-RXN-141A; TRANS-RXN-499; TRANS-RXN-8

Predicted SEED Role

"Zinc transporter ZupT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>EX28DRAFT_3077 Predicted divalent heavy-metal cations transporter (Enterobacter asburiae PDN3)
MSVPLILTILAGAATFIGAILGVLGQKPSNRVLAFSLGFAAGIMLLISLMEMLPAALGTE
GMSPLLGYGMFVFGLLGYFALDRMLPHAHPQDLMQKNVTPMPRNIKRTAVLLTLGISLHN
FPEGVATYVTASSNLEMGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAVFWAGISGMA
EILGGVLAWLILGSLVSPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG
MSVMGLSLVLLQTAGIG