Protein Info for EX28DRAFT_3072 in Enterobacter asburiae PDN3

Annotation: nudix-type nucleoside diphosphatase, YffH/AdpP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family" amino acids 14 to 199 (186 residues), 267 bits, see alignment E=3.8e-84 PF00293: NUDIX" amino acids 60 to 179 (120 residues), 45.3 bits, see alignment E=4.5e-16

Best Hits

Swiss-Prot: 89% identical to ADPP_ECOLI: ADP-ribose pyrophosphatase (nudF) from Escherichia coli (strain K12)

KEGG orthology group: K01515, ADP-ribose pyrophosphatase [EC: 3.6.1.13] (inferred from 98% identity to enc:ECL_04362)

MetaCyc: 89% identical to ADP-sugar pyrophosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-7309 [EC: 3.6.1.76]; ADP-sugar diphosphatase. [EC: 3.6.1.76, 3.6.1.21]

Predicted SEED Role

"ADP-ribose pyrophosphatase (EC 3.6.1.13)" in subsystem NAD and NADP cofactor biosynthesis global or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.13 or 3.6.1.21 or 3.6.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>EX28DRAFT_3072 nudix-type nucleoside diphosphatase, YffH/AdpP family (Enterobacter asburiae PDN3)
MQKPEKLPVTFAKNDVEIIARETLYSGFFSMDLYRFRHRLFNGEMSGEIRREIFERGHAA
VLLPFDPVRDEVVLVEQIRIAAYDVSESPWLLEMVAGMIEEGETVEDVARREALEEAGLV
VGRTKPVLSYLASPGGTSERLSIMVGEVDATTAEGIHGLADENEDIRVHVVSREQAYQWV
EEGKIDNAASVIALQWLQLHYQTLRNEWKK