Protein Info for EX28DRAFT_3064 in Enterobacter asburiae PDN3

Annotation: ABC-type Fe3+-siderophore transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 53 (53 residues), see Phobius details transmembrane" amino acids 76 to 96 (21 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 231 to 242 (12 residues), see Phobius details amino acids 251 to 251 (1 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details PF01032: FecCD" amino acids 36 to 340 (305 residues), 255.7 bits, see alignment E=2.7e-80

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 81% identity to ent:Ent638_3439)

Predicted SEED Role

"putative permease of ferrichrome ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>EX28DRAFT_3064 ABC-type Fe3+-siderophore transport system, permease component (Enterobacter asburiae PDN3)
MNRAGFCAVRIGRLSALVRPRALACLTLLALVALSLLGFGLTHGSLPVPTSAIGRALFSP
ESLTAETRYIVMDIRLPRLLMAVLCGAMLGMAGAAMQSITRNGLADPGLIGVKEGCSAAV
LLLIFQFPALGLAWRPLVGMAGGLLTALLVIGLARDISRPRFILIGIGVSWAFAAAMGVF
MTTADVRDVQTAMLWLAGSLHAANWTLVGLAALWAAPAFALLLFTARAADVALLGNQAAT
GLGVRTTRLALLRVLAPVVLTAACVSCVGSIGFVGLIAPHMARLLLRGGQTALLTGSAVL
GALLVLLADNVGRLAFLPLQLPAGIVISLIGGPFFLLLLWQRRDRF