Protein Info for EX28DRAFT_3058 in Enterobacter asburiae PDN3

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 164 to 182 (19 residues), see Phobius details PF00512: HisKA" amino acids 237 to 301 (65 residues), 46.6 bits, see alignment E=2.9e-16 PF02518: HATPase_c" amino acids 349 to 447 (99 residues), 83.5 bits, see alignment E=1.5e-27

Best Hits

Swiss-Prot: 71% identical to QSEC_SALTY: Sensor protein QseC (qseC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07645, two-component system, OmpR family, sensor histidine kinase QseC [EC: 2.7.13.3] (inferred from 88% identity to enc:ECL_04344)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>EX28DRAFT_3058 Signal transduction histidine kinase (Enterobacter asburiae PDN3)
MKLTQRLSLKLRLTLLFLLLSLTAWFAASVVAWQQTTHKLDKLSDTQQMLFAKRLLTMDL
DEIRAPERMRDIPKKVKHGRLDDDALAFAIYAVDGKMLLNDGENGRDISYHYRRDGFDNG
QLQGDNDEWRFLWLTSPDGKYRVVVGQEWEYRQEMALDVVSSQLTPWLVALPVMLLLLIV
LLRRELKPLKKLAQTLRSRSPDATDNLPTEGLPAEVRPLLDALNHLFARTQEMMTRERRF
TSDAAHELRSPLAALKVQTDVAQLYQDDPEAQSKGLSQLHAGIDRASRLVDQLLTLSRLD
SLDNLDDVEPIPLADLLQSAVLDIWHPAQQAGIDIRLNIHAPEVTRTGQQLLLSLLVRNL
LDNAIRYSPRGSTVDVTLDARGFTVRDNGPGISPDALARIGERFYRPPGQDATGSGLGLS
IVKRVAALHGMRVSLSNAPEGGFEVKVSW