Protein Info for EX28DRAFT_3052 in Enterobacter asburiae PDN3

Annotation: potassium uptake protein, TrkH family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 341 to 365 (25 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details amino acids 433 to 449 (17 residues), see Phobius details amino acids 463 to 489 (27 residues), see Phobius details PF02386: TrkH" amino acids 47 to 485 (439 residues), 391.8 bits, see alignment E=2.1e-121 TIGR00933: potassium uptake protein, TrkH family" amino acids 92 to 474 (383 residues), 367.3 bits, see alignment E=5.3e-114

Best Hits

Swiss-Prot: 70% identical to TRKG_ECOLI: Trk system potassium uptake protein TrkG (trkG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to enc:ECL_04338)

MetaCyc: 70% identical to Rac prophage; Na+-dependent K+ transporter TrkG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-188

Predicted SEED Role

"Trk system potassium uptake protein TrkG" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>EX28DRAFT_3052 potassium uptake protein, TrkH family (Enterobacter asburiae PDN3)
MKPNDSLHVSQLRVVLHLCGFLVLLYSLSMLPPMVIALLNKERTYFAFLTTFLTFFTLGG
LTWRATRHAGIQLRTRDGFVIIVLFWLLFSFISAMPLWMDDGLQLSFADALFEGVSGITT
TGATVIGDVSALPKSYLYYRAQLNFIGGLGVIVLAVAVLPLLGIGGMKLYQSEMPGPFKE
ERLTPRLADTARTLWVTYFALGVACTLAYWLAGMSFFDALCHGLSTVSLGGFSTRSESIG
FYDSHAIELVAGAFSLLSAFNFTLWYVAIVRRTLKPIRRSPEVKFFLSAAAVIIVITAWQ
VWHAGMYNATDSLVHAFFLASSMMTDNGLSTADYAQWPAHTIFLLLSASFFGGCVGSTCG
GIKALRFLIMFKQSIQEMNQLAHPRALLSIKVGKSVVNERVLRSVWSFFFLYVMITGFFV
WSLNLMGYDLFTSFATVAACINNMGLGFGETASTFGTLTEGAKLLMCAAMILGRLEIYPV
LILFSRFFWRA