Protein Info for EX28DRAFT_3047 in Enterobacter asburiae PDN3

Annotation: Uncharacterized membrane-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details PF09335: VTT_dom" amino acids 48 to 173 (126 residues), 69.7 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 86% identical to YGHB_ECOL6: Inner membrane protein YghB (yghB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to enc:ECL_04331)

Predicted SEED Role

"DedA family inner membrane protein YghB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>EX28DRAFT_3047 Uncharacterized membrane-associated protein (Enterobacter asburiae PDN3)
MAVIQDIIAALWHHDFAALADPHIVGIVYLVMFATLFLENGLLPASFLPGDSLLLLAGAL
IGKGVMDFTPTMVILTSAASLGCWLSYLQGRWLGNTRVVKGWLAQLPHKYHQRATCMFDR
HGLLALLAGRFLAFVRTLLPTMAGISGLSNRRFQFFNWLSALLWVGVVTTLGYALNMIPF
VKHHEDQVMTFLMVLPMFLLVAGLVGTIAVVIKKKYCSA