Protein Info for EX28DRAFT_3040 in Enterobacter asburiae PDN3

Annotation: TIGR00645 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details TIGR00645: TIGR00645 family protein" amino acids 1 to 160 (160 residues), 256.3 bits, see alignment E=8.1e-81 PF03350: UPF0114" amino acids 9 to 125 (117 residues), 131.9 bits, see alignment E=7e-43

Best Hits

Swiss-Prot: 93% identical to Y3411_ENT38: UPF0114 protein Ent638_3411 (Ent638_3411) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 98% identity to enc:ECL_04324)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>EX28DRAFT_3040 TIGR00645 family protein (Enterobacter asburiae PDN3)
MERFFENAMYASRWILAPVYFGLSLALIALTIKFFQEIWHVLPNIFSIAEADLILVLLSL
VDMTLVGGLLVMVMFSGYENFVSQLDIDERKEKLSWLGKMDASSLKNKVAASIVAISSIH
LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDKISKK