Protein Info for EX28DRAFT_3019 in Enterobacter asburiae PDN3

Annotation: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03938: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB" amino acids 49 to 638 (590 residues), 843.3 bits, see alignment E=4.9e-258 PF01522: Polysacc_deac_1" amino acids 102 to 270 (169 residues), 78.1 bits, see alignment E=5.7e-26 PF14883: GHL13" amino acids 318 to 479 (162 residues), 257.8 bits, see alignment E=1.4e-80 amino acids 479 to 618 (140 residues), 171.5 bits, see alignment E=2.5e-54

Best Hits

KEGG orthology group: K11931, biofilm PGA synthesis lipoprotein PgaB [EC: 3.-.-.-] (inferred from 88% identity to enc:ECL_04314)

Predicted SEED Role

"Biofilm PGA synthesis deacetylase PgaB (EC 3.-)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (645 amino acids)

>EX28DRAFT_3019 poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB (Enterobacter asburiae PDN3)
MLNTRFSVSLILLGWLCLSASVCAQAISFIAPKDRPQLEASKPWPENQFLVLAYHDVEDD
AADQRYLSVRTSALNEQISWLLHNGYHAISVQDILEAHDGKKTLPPKAVLLSFDDGYSSF
YTRVWPLLQAWNVPALWAPVGSWVDMPANQKVNFGGLMTPRDRFATWDMVRELSQSPLIE
IGSHTWASHYGIPANPQGSREPAIANRFYDKATGSYETDQQFSQRIGDDVRKVTEKITQV
TGKAPRAWVWPYGAASGTSLAIARQQGYRLAFTLEDGLGNVQDLGNIPRLLIAGNPSLKA
FASTVSQVQERDPVRVMHVDLDYVYDPDPAQQTQNINRLIQRVYDMKISHVFLQAFADPQ
GDGRIKALYFPNRRLPVRADLFNFVAWQLQTRAGVKVFAWMPVLSFDLDPSLPRVQRRDR
QTGQLQEATEPYIRLSPWDPQVRQQVTDIYEDLARYASFNGILFHDDAALTDVDDAGQNT
TRQKSQTLIGFTHALSLAVKHIRGPQIKTARNMFALPILQPESEAWFAQNLDDFLAEYDW
TVPMAMPLMESVPADESDAWLTRLVKVVAARPGALDKTIFELQARDWDRKPQRAVSDSQL
AQWMRVLQLNGIKNYGYYPDDFLNNQPDISRIRPEFSSYWYPDND