Protein Info for EX28DRAFT_3010 in Enterobacter asburiae PDN3

Annotation: Signal transduction histidine kinase regulating citrate/malate metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details PF17203: sCache_3_2" amino acids 38 to 158 (121 residues), 65 bits, see alignment E=2.5e-21 PF13188: PAS_8" amino acids 212 to 264 (53 residues), 28.3 bits, see alignment 3.8e-10 PF00989: PAS" amino acids 213 to 276 (64 residues), 23.6 bits, see alignment E=1.3e-08 PF14689: SPOB_a" amino acids 321 to 372 (52 residues), 30.7 bits, see alignment 5.5e-11 PF14501: HATPase_c_5" amino acids 420 to 512 (93 residues), 40.6 bits, see alignment E=6.2e-14 PF02518: HATPase_c" amino acids 421 to 528 (108 residues), 66.1 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: K07700, two-component system, CitB family, cit operon sensor histidine kinase CitA [EC: 2.7.13.3] (inferred from 94% identity to enc:ECL_04301)

Predicted SEED Role

"Sensor kinase CitA, DpiB (EC 2.7.3.-)" in subsystem Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>EX28DRAFT_3010 Signal transduction histidine kinase regulating citrate/malate metabolism (Enterobacter asburiae PDN3)
MKVSFQIKLFISLVAFFSVLFALLGGYYYADVGKQLYQEMSTRAKIQAEEIALIPTLRNE
VEQKNINAIHDFMQKISAHSDASFIVIGDNKGQHLFHSVFADRVGTTLVGGDNEAVLQGK
STTTIRKGGLGISLRSKAPIFNAAGQVVGIVSVGYLTSYLDTITVSKVVNILIAAVLLLI
ALFIFSWFFTRSIKKQIFSLEPREIGLLVRQQKAMMESIYEGVIAIDDRRRIEVINQAAR
KLLGLSQPARELRGQLISQVIDPVPFFDTQTMLAKDTHDEICRFNDLTVIASRVHIMLEG
SLQGWVITFRDRNEIDSLSAQLSQVKRYVDNLRIMRHEQLNRMTTLSGLLHMGRYEEAIG
YIQAQSEHAQELLDFISSRFSSPTLCGLLLGKAARAREKGVELCFDPGCRLDRPFLPLGE
QELISIIGNLLDNAIEATQRSPLPHAPVEVLIKLSEQELIIEVADQGVGITPAIRDRIFE
RGITTKTRGDHGIGLYLIESYVTQAGGAIEVADNTPRGAIFSLFIPATGTARQLEDTDYA
T