Protein Info for EX28DRAFT_2990 in Enterobacter asburiae PDN3

Annotation: Predicted integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 5 to 5 (1 residues), see Phobius details transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 90 to 118 (29 residues), see Phobius details amino acids 148 to 173 (26 residues), see Phobius details PF02325: CCB3_YggT" amino acids 1 to 80 (80 residues), 83.7 bits, see alignment E=4.7e-28 amino acids 93 to 172 (80 residues), 64.5 bits, see alignment E=4.4e-22

Best Hits

Swiss-Prot: 85% identical to YGGT_ECOLI: Uncharacterized protein YggT (yggT) from Escherichia coli (strain K12)

KEGG orthology group: K02221, YggT family protein (inferred from 97% identity to enc:ECL_04281)

Predicted SEED Role

"Integral membrane protein YggT, involved in response to extracytoplasmic stress (osmotic shock)" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>EX28DRAFT_2990 Predicted integral membrane protein (Enterobacter asburiae PDN3)
MKTLTFLLSTVLELYTMALLLRVWMQWARCDFYNPFSQFVVKITQPVVGPLRRIIPAMGP
IDSSSLLVAFILSVIKAIVLFMVITFQPIIWIAAVLILVKTVGLLIFWVLLVMAIMSWVS
QGRSPVEYALIQLAEPLLRPIRNLLPSMGGIDFSPMILVLLLYVVNMGIAELLQSTGNML
LPGLWMAL