Protein Info for EX28DRAFT_2984 in Enterobacter asburiae PDN3

Annotation: RNA methyltransferase, RsmE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR00046: RNA methyltransferase, RsmE family" amino acids 2 to 242 (241 residues), 301.2 bits, see alignment E=2.3e-94 PF20260: PUA_4" amino acids 20 to 66 (47 residues), 49.6 bits, see alignment 3.4e-17 PF04452: Methyltrans_RNA" amino acids 75 to 236 (162 residues), 185.5 bits, see alignment E=5.7e-59

Best Hits

Swiss-Prot: 88% identical to RSME_SHIFL: Ribosomal RNA small subunit methyltransferase E (rsmE) from Shigella flexneri

KEGG orthology group: K09761, ribosomal RNA small subunit methyltransferase E [EC: 2.1.1.-] (inferred from 99% identity to enc:ECL_04275)

MetaCyc: 88% identical to 16S rRNA m3U1498 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11598 [EC: 2.1.1.193]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.193

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>EX28DRAFT_2984 RNA methyltransferase, RsmE family (Enterobacter asburiae PDN3)
MRIPRIYHPELITAGREIALSDDAANHVGRVLRMGAGQAIQLFDGSNQVFDAEITRSDKK
SVHVNVLRGEVDDRESPLHIHLGQVMSRGEKMEFTIQKSIELGVSLITPLFSERCGVKLD
AERLNKKIQQWQKIAIAACEQSGRNRIPEIRPAMDLEDWCAEEESGLKLNLHPRASASIN
TLPLPVERVRLLIGPEGGLSADEIAMTARYQFTDILLGPRVLRTETTALTAITALQVRFG
DLG