Protein Info for EX28DRAFT_2970 in Enterobacter asburiae PDN3

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 96 to 125 (30 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 15 to 64 (50 residues), 51.2 bits, see alignment 1.9e-17 PF21088: MS_channel_1st" amino acids 72 to 112 (41 residues), 35.4 bits, see alignment 1.7e-12 PF00924: MS_channel_2nd" amino acids 114 to 180 (67 residues), 75.2 bits, see alignment E=6.9e-25 PF21082: MS_channel_3rd" amino acids 187 to 268 (82 residues), 67.5 bits, see alignment E=2.3e-22

Best Hits

Swiss-Prot: 86% identical to MSCS_ECOLI: Small-conductance mechanosensitive channel (mscS) from Escherichia coli (strain K12)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 98% identity to enc:ECL_04244)

MetaCyc: 86% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>EX28DRAFT_2970 Small-conductance mechanosensitive channel (Enterobacter asburiae PDN3)
MEQLDVVDSINNAGNWLVRNQALLLSYAVNIVAAIAIIIIGMIVARIVSNAVNRVMLARH
IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAIGLALQGSLSNLAA
GVLLVTFRPFRSGEYVDLGGIAGTVLQVQIFSTTMRTVDGRIVVVPNGKIIAGNIINFSR
EPVRRNELIISVAYDSDIDQVKSLISNIIASDDRILKDKEQTVRLNELGASSINFVVRIW
SKSSDLQNVYWDVLERIKRDFDANGISFPYPQMDVNVKKVKEAE