Protein Info for EX28DRAFT_2958 in Enterobacter asburiae PDN3

Annotation: Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 4 to 345 (342 residues), 113.2 bits, E=4.9e-36
• TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family
  • amino acids 5 to 391 (387 residues), 444.8 bits, E=1.2e-137
• PF00890: FAD_binding_2
  • amino acids 5 to 38 (34 residues), 22.1 bits, 2.5e-08
• PF01266: DAO
  • amino acids 5 to 37 (33 residues), 28.1 bits, see alignment (E = 4.5e-10)
• PF08491: SE
  • amino acids 276 to 368 (93 residues), 21.3 bits, E=3.8e-08

Best Hits

Swiss-Prot: 84% identical to UBII_ECOLI: 2-octaprenylphenol hydroxylase (ubiI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to enc:ECL_04233)

MetaCyc: 84% identical to 2-octaprenylphenol 6-hydroxylase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYLPHENOL-HYDROX-RXN [EC: 1.14.13.240]

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Bisphenol A degradation
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Cyanoamino acid metabolism
• Flavonoid biosynthesis
• Histidine metabolism
• Isoflavonoid biosynthesis
• Limonene and pinene degradation
• Methane metabolism
• Naphthalene and anthracene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Styrene degradation
• Toluene and xylene degradation
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.240

Protein Sequence (400 amino acids)

>EX28DRAFT_2958 Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family (Enterobacter asburiae PDN3)
MQNVDVAIVGGGMVGLALACGLQGSGLRVAVLEQKQPQPVAPDAPPELRVSAINAASEKL
LTHLGVWADIVAQRASCYHGMEVWDKDSFGHIAFDDESMGYSHLGHIIENAVIHHALWQK
AQQCSDVTLIAPAQIQQVAWGENEAFITLQSGDMLTARLVVGADGANSWLRNKADIPLTF
WDYRHHAMVATIRTEEPHGGVARQTFHNDGILAFLPLSDPHLCSIVWSLVPEKAQQMQEA
TPDAFNQALCVAFDNRLGLCTLESERQVFPLTGRYARQFAAHRLALVGDAAHTIHPLAGQ
GVNLGFMDAAELVEELRRLHREGKDIGQHLYLRRYERSRKHSAAMMLAGMQGFRELFAGA
NPAKKLLRDIGLKLADTLPGVKPQLLRQAMGLNDLPDWLR