Protein Info for EX28DRAFT_2946 in Enterobacter asburiae PDN3

Annotation: flavodoxin, long chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR01752: flavodoxin" amino acids 2 to 168 (167 residues), 224.5 bits, see alignment E=2.8e-71 PF00258: Flavodoxin_1" amino acids 5 to 160 (156 residues), 79.2 bits, see alignment E=1.8e-26

Best Hits

Swiss-Prot: 88% identical to FLAW_SALTI: Flavodoxin 2 (fldB) from Salmonella typhi

KEGG orthology group: K03840, flavodoxin II (inferred from 95% identity to enc:ECL_04221)

MetaCyc: 87% identical to flavodoxin 2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Flavodoxin 2" in subsystem Flavodoxin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>EX28DRAFT_2946 flavodoxin, long chain (Enterobacter asburiae PDN3)
MNIGLFYGSSTCYTEMAAEKIRDIIGPELVTLHNLKDDAVALMEQYDVLILGIPTWDFGE
IQEDWEAIWDQLDSVNLDGKIIAMYGMGDQLGYGEWFLDALGMLHDKLAPKGVSFIGYWP
TEGYEFTSKKPIIADGELFVGLALDETNQYDLSDERLQSWCEQILGEMAEKFS