Protein Info for EX28DRAFT_2942 in Enterobacter asburiae PDN3

Annotation: bacterial peptide chain release factor 2 (bRF-2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR00020: peptide chain release factor 2" amino acids 3 to 363 (361 residues), 593.2 bits, see alignment E=8.4e-183 PF03462: PCRF" amino acids 31 to 219 (189 residues), 203.5 bits, see alignment E=3e-64 PF00472: RF-1" amino acids 228 to 337 (110 residues), 143.2 bits, see alignment E=3.4e-46

Best Hits

Swiss-Prot: 98% identical to RF2_KLEP3: Peptide chain release factor 2 (prfB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 97% identity to eco:b2891)

Predicted SEED Role

"Peptide chain release factor 2; programmed frameshift-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>EX28DRAFT_2942 bacterial peptide chain release factor 2 (bRF-2) (Enterobacter asburiae PDN3)
MFEINPVKNRIQDLTERSDVLRGYLDYDAKKERLEEVNAELEQPDVWNEPERAQALGKER
SSLEAIVDTLDQMAQGLEDVSGLLELAVEADDEETFNEAVAELDVLEEKLAQLEFRRMFS
GEYDSADCYLDIQAGSGGTEAQDWASMLTRMYLRWAEARGFKTEIIEESEGEVAGLKSVT
IKIIGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSAFVYPEVDEDIDIEINPADLR
IDVYRASGAGGQHVNRTESAVRITHIPTGLVTQCQNDRSQHKNKDQAMKQMKAKLYELEM
QKKNAEKQAMEDNKSDIGWGSQIRSYVLDDSRIKDLRTGVETRNTQAVLDGSLDQFIEAS
LKAGL