Protein Info for EX28DRAFT_2939 in Enterobacter asburiae PDN3

Annotation: Membrane proteins related to metalloendopeptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01476: LysM
  • amino acids 42 to 84 (43 residues), 63.3 bits, 1.7e-21
• PF01551: Peptidase_M23
  • amino acids 141 to 234 (94 residues), 114.8 bits, E=1.7e-37

Best Hits

Swiss-Prot: 74% identical to YGER_ECOLI: Uncharacterized lipoprotein YgeR (ygeR) from Escherichia coli (strain K12)

KEGG orthology group: K12943, lipoprotein YgeR (inferred from 95% identity to enc:ECL_04213)

MetaCyc: 74% identical to amidase activator (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Uncharacterized lipoprotein YgeR precursor"

Protein Sequence (247 amino acids)

>EX28DRAFT_2939 Membrane proteins related to metalloendopeptidases (Enterobacter asburiae PDN3)
MFAGSLTRNPITAIFCLTLTLLLAGCSGSKSSDMGSYSGSVYTVKRGDTLYRISRATGTS
VKDLARMNNLSPPYTIEVGQQLKVSGGSSSGKKSSSKGKTAKVTPSYQVPQSSWPPVGQR
CWIWPASGKVVAPYSLSEGGNKGIDIAAARGTPVYASGAGKVVYVGNQLRGYGNLIMIKH
GEDYITAYAHNDTMLVNNGQNVKAGQKIATMGSTGTDAVKLHFQIRYKATAIDPQRYLPA
PGSKPKC