Protein Info for EX28DRAFT_2933 in Enterobacter asburiae PDN3

Annotation: ABC-type Fe3+ transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13531: SBP_bac_11" amino acids 50 to 302 (253 residues), 41.7 bits, see alignment E=2.4e-14 PF01547: SBP_bac_1" amino acids 55 to 298 (244 residues), 47.3 bits, see alignment E=6e-16 PF13416: SBP_bac_8" amino acids 60 to 311 (252 residues), 69 bits, see alignment E=1.2e-22 PF13343: SBP_bac_6" amino acids 134 to 313 (180 residues), 47.3 bits, see alignment E=3.8e-16

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 90% identity to rah:Rahaq_1567)

Predicted SEED Role

"Putative ABC transporter, periplasmmic iron binding protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>EX28DRAFT_2933 ABC-type Fe3+ transport system, periplasmic component (Enterobacter asburiae PDN3)
MSNTFRISLLTATVLFSASALSALPQGYPAEYQKVVDAATKEGKVVIYSTTDIKAAGPLI
QGFEKTYPGIKVEYNDMNSTELYNRFISEQASGGVSGDVVWSSSMDTGLKLATDYAMEYK
SPEQSQLPKWAVWKDKAYGTTYEPVVFIYNKRLIPAGDVPDSHAALAKLIASQTDKFKGK
VTTYDIEKSGLGFMLSVQDHNADPNYFKTLADVAKGGLSVQSSTGTMMERVSSGENLIGF
NILGSYAEARAKNDPSLGISYPKDYTLVLSRVSFISQQSQNSNAAKLWLDYVLSEQGQNI
LANQADIPSIRNDIEGKNDIDGLTKILGNALKPIPVDETLLEYLQPKKRLEYIKEWRTAA
GK