Protein Info for EX28DRAFT_2932 in Enterobacter asburiae PDN3

Annotation: Response regulator of citrate/malate metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00072: Response_reg" amino acids 9 to 120 (112 residues), 75.8 bits, see alignment E=3e-25 PF20714: HTH_64" amino acids 165 to 227 (63 residues), 48 bits, see alignment E=1.2e-16

Best Hits

Swiss-Prot: 43% identical to CITB_KLEPN: Transcriptional regulatory protein CitB (citB) from Klebsiella pneumoniae

KEGG orthology group: K07702, two-component system, CitB family, response regulator CitB (inferred from 73% identity to rah:Rahaq_0757)

Predicted SEED Role

"Transcriptional regulatory protein CitB, DpiA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>EX28DRAFT_2932 Response regulator of citrate/malate metabolism (Enterobacter asburiae PDN3)
MSTTRPLDVVIVEDEPHLAELHREYIEQNFHLRVVGIAASIEQACSLIRQHQPRLILLDN
YLPDGKGVELIDNPLLKSYECSVIFITAASDMQTCSHAMRSGAFDYLIKPVFFQRLHASL
ERFMRFIHTVQQVKVVDQHALDRLFNLPAAEASITPSTKGIEPQTLERIKNLFAEHPDTA
MSVEEVVENVGISKTTGRRYLEYCVESGLISVEMLYGNIGHPRRLYRKAPDKP