Protein Info for EX28DRAFT_2919 in Enterobacter asburiae PDN3

Annotation: Chain length determinant protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details PF02706: Wzz" amino acids 26 to 122 (97 residues), 60.6 bits, see alignment E=7.6e-21

Best Hits

Swiss-Prot: 58% identical to FEPE_ECOLI: Ferric enterobactin transport protein FepE (fepE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to enc:ECL_04169)

Predicted SEED Role

"Ferric enterobactin uptake protein FepE" in subsystem Siderophore Enterobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>EX28DRAFT_2919 Chain length determinant protein (Enterobacter asburiae PDN3)
MSEMDIKKSTDLDFPRYTSPAIHAKEIDLFGLLAVLLAAKKRIVTITLAFALAGLAISFL
LPQKWTSKAVITQAESSQWNPLRQMMVALQVLDVDAKISRPEVFDMFIKKFQSQSLLEEY
LKSSPYVMSQLKDAEVDPLELHRAIVNISDRMKAVNDAQGKDADKAPFVSWTLSFTAPTA
DDAQAVLDGYIDYIAAIVEKETVQNIRNQIALKKNVVEQQLELDRVRLTNIHNTNLQRLN
YSLEVANAAGIKKPVYSNGQAVKDDPDYSVALGADGIAQKLQIEKNLKDVTELNAEFQNR
EYYLAQLKKLSFADVKLEPFRYQLSPSMPVKKDGPGKALIVVLAALLGGLFACGSVLLRE
AMLARTSPPEPVAE