Protein Info for EX28DRAFT_2902 in Enterobacter asburiae PDN3

Annotation: thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00303: Thymidylat_synt
  • amino acids 2 to 264 (263 residues), 431.5 bits, E=5.1e-134
• TIGR03284: thymidylate synthase
  • amino acids 2 to 85 (84 residues), 141.6 bits, E=1.5e-45
  • amino acids 84 to 264 (181 residues), 312.1 bits, E=1.7e-97

Best Hits

Swiss-Prot: 98% identical to TYSY_ENT38: Thymidylate synthase (thyA) from Enterobacter sp. (strain 638)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 100% identity to enc:ECL_04149)

MetaCyc: 96% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• pyrimidine deoxyribonucleosides salvage (4/5 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Protein Sequence (264 amino acids)

>EX28DRAFT_2902 thymidylate synthase (Enterobacter asburiae PDN3)
MKQYLELMKKVLDEGTPKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL
WFLQGDTNVAYLHENNVSIWDEWADENGNLGPVYGKQWRAWPTPDGRHIDQITTVMNQLK
NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS
YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMEQTHLQLTREPRALPKLIIKRKPASIF
DYRFDDFEIEGYDPHPGIKAPVAI