Protein Info for EX28DRAFT_2848 in Enterobacter asburiae PDN3

Annotation: sulfate adenylyltransferase, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR02039: sulfate adenylyltransferase, small subunit" amino acids 9 to 302 (294 residues), 558.3 bits, see alignment E=2.3e-172 PF01507: PAPS_reduct" amino acids 29 to 256 (228 residues), 204.6 bits, see alignment E=6.4e-65

Best Hits

Swiss-Prot: 99% identical to CYSD_KLEP7: Sulfate adenylyltransferase subunit 2 (cysD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 97% identity to ecr:ECIAI1_2854)

MetaCyc: 97% identical to sulfate adenylyltransferase subunit 2 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>EX28DRAFT_2848 sulfate adenylyltransferase, small subunit (Enterobacter asburiae PDN3)
MDQKRLTHLRQLEAESIHIIREVAAEFSNPVMMYSIGKDSSVMLHLARKAFYPGTLPFPL
LHVDTGWKFREMYEFRDRTAKAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLK
QALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWHNYNGQINKGES
IRVFPLSNWTELDIWQYIYLENIEIVPLYLAAERPVLERDGMLMMIDDDRIDLQPGEVIK
QQMVRFRTLGCWPLTGAVESSAQTLPEIIEEMLVSTTSERQGRVIDRDQAGSMELKKRQG
YF