Protein Info for EX28DRAFT_2847 in Enterobacter asburiae PDN3

Annotation: sulfate adenylyltransferase, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00009: GTP_EFTU
  • amino acids 26 to 233 (208 residues), 159 bits, E=1.6e-50
• TIGR02034: sulfate adenylyltransferase, large subunit
  • amino acids 28 to 434 (407 residues), 690.5 bits, E=7.9e-212
• TIGR00231: small GTP-binding protein domain
  • amino acids 34 to 214 (181 residues), 50.2 bits, E=2.5e-17
• PF01926: MMR_HSR1
  • amino acids 86 to 169 (84 residues), 23 bits, E=1.1e-08
• PF03144: GTP_EFTU_D2
  • amino acids 265 to 324 (60 residues), 31 bits, E=4.2e-11

Best Hits

Swiss-Prot: 89% identical to CYSN_CITK8: Sulfate adenylyltransferase subunit 1 (cysN) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K00956, sulfate adenylyltransferase subunit 1 [EC: 2.7.7.4] (inferred from 96% identity to enc:ECL_04100)

MetaCyc: 88% identical to sulfate adenylyltransferase subunit 1 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• assimilatory sulfate reduction II (1/3 steps found)
• sulfite oxidation III (1/3 steps found)
• selenate reduction (2/5 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (2/12 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Protein Sequence (474 amino acids)

>EX28DRAFT_2847 sulfate adenylyltransferase, large subunit (Enterobacter asburiae PDN3)
MNTTIAQQIANEGGVEAYLHAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLS
SLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQY
TRNMATGASTCDLAILLMDARKGVLDQTRRHSFISTLLGIKHLVVAVNKMDLVNFSEDKF
EEIRQSYLTFAEQLPGNLDIRFVPLSALEGDNVASQSANMPWYSGPTLLEVLETVEIQRV
VDTQPMRFPVQYVNRPNLDFRGFSGTLASGSVKVGQRVKVLPSSVESTIARIVTFDGDLQ
EAGAGEAVTLVLKDEIDISRGDLLVDAQETLAAVQGASVDVVWMAEQPLTAGQSYDIKIA
GKKTRARVDGIQFQVDINNLTQRDVTELPLNGIGLVDLTFDEPLVLDPYQQNPVTGGLIF
IDRLTNVTVGAGMVREPIKQSAATSEFSAFELELNALVRKHFPHWGARDLLGGK