Protein Info for EX28DRAFT_2842 in Enterobacter asburiae PDN3
Annotation: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to ISPF_SHIFL: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (ispF) from Shigella flexneri
KEGG orthology group: K01770, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC: 4.6.1.12] (inferred from 99% identity to eco:b2746)MetaCyc: 99% identical to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. [EC: 4.6.1.12]
Predicted SEED Role
No annotation
MetaCyc Pathways
- methylerythritol phosphate pathway I (9/9 steps found)
- methylerythritol phosphate pathway II (9/9 steps found)
- superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
- isoprene biosynthesis I (9/10 steps found)
- taxadiene biosynthesis (engineered) (11/13 steps found)
- superpathway of ergosterol biosynthesis II (11/26 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Terpenoid biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.6.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (159 amino acids)
>EX28DRAFT_2842 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12) (Enterobacter asburiae PDN3) MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKL FPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDL GCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLLKASK