Protein Info for EX28DRAFT_2830 in Enterobacter asburiae PDN3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 73 PF26358: EcdD_BsdD_detox" amino acids 2 to 51 (50 residues), 97 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 92% identical to ECDD_ECO57: Protein EcdD (ecdD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 92% identity to eok:G2583_3385)

Predicted SEED Role

"Hydroxyaromatic non-oxidative decarboxylase protein D (EC 4.1.1.-)" (EC 4.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (73 amino acids)

>EX28DRAFT_2830 hypothetical protein (Enterobacter asburiae PDN3)
MICPRCADEHIEVMATSPVKGVWTVYQCQHCLYTWRDTEPLRRTSREHYPEAFRMTQKDI
DEAPQVPTIPPLL