Protein Info for EX28DRAFT_2826 in Enterobacter asburiae PDN3

Annotation: Major Facilitator Superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 361 (347 residues), 115.6 bits, see alignment E=2.4e-37

Best Hits

KEGG orthology group: None (inferred from 90% identity to enc:ECL_04075)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>EX28DRAFT_2826 Major Facilitator Superfamily (Enterobacter asburiae PDN3)
MPLRPAATLWPPVLLGSQFVFNIGFYAVVPFLAIFLRDDMLLSGGLIGLILGLRTFSQQG
MFIVGGALSDRFGAKVIILSGCIVRVSGYLLLAFGESLWPIILGACLTGVGGALFSPSIE
ALLAKAGTHSEAKGKRSRAEWFALFAVCGELGAVLGPVAGALLTGFGFRQVALAGAGVFV
IALVVLYFCLPAAGHRSQTLKIQPWWTTFRQPRFVAFIIAYSSWLLSYNQLYLALPVEIQ
RSGGNEKDLGPLFMLASVLIITLQLPLARFARRVGAVRILPVGFLLLSAAFASVATFAPM
TPPEGWLRLLPSVCFVTLLTMGQMLLVPSAKDLIPLFAEESTLGAHYGALATAGGIAVLA
GNLLFGSLLDRALVPSTQAMYPWLLLALFPLCSALALKVICRPLRR