Protein Info for EX28DRAFT_2824 in Enterobacter asburiae PDN3

Annotation: ABC-type Fe3+-siderophore transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 238 to 282 (45 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details PF01032: FecCD" amino acids 24 to 341 (318 residues), 291.6 bits, see alignment E=6.3e-91 PF00950: ABC-3" amino acids 111 to 328 (218 residues), 22.6 bits, see alignment E=6.9e-09

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 96% identity to enc:ECL_04073)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>EX28DRAFT_2824 ABC-type Fe3+-siderophore transport system, permease component (Enterobacter asburiae PDN3)
MTAAVLQARQGLVLTTSGLLALVLLFLTIALSVSVGELSIPLDNVFYAISNKMGLTEVPL
TRIYESVIWDFRLSRALVAACCGAGLAICGAVLQSLLKNALAEPYVLGVSAGASTGAVSV
VVLGIGTGAVSLSAGAFAGAFAAFAFVAFLTNGARGGNERTILAGVAASQLFNAITAYTI
STSASAQQARDVMFWLLGSFSGVRWPEFQLALVVVLAGLAVCLYYSRALDAFTFGDDAAA
SLGIAVPWVRLALFTTTALITATIVSMAGSIGFVGLVVPHVMRFLFGPLHRTLLIASALA
GAILMVLADIASRMLIAPQSLPVGVVTALVGVPFFAVIIYRSRNK