Protein Info for EX28DRAFT_2806 in Enterobacter asburiae PDN3

Annotation: Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 106 to 127 (22 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 217 to 234 (18 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 280 to 282 (3 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 334 to 349 (16 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 433 to 455 (23 residues), see Phobius details PF00367: PTS_EIIB" amino acids 11 to 43 (33 residues), 58.7 bits, see alignment (E = 2.9e-20) PF02378: PTS_EIIC" amino acids 113 to 396 (284 residues), 142.7 bits, see alignment E=1.5e-45

Best Hits

Swiss-Prot: 89% identical to PTIBC_ECOLI: PTS system arbutin-, cellobiose-, and salicin-specific EIIBC component (ascF) from Escherichia coli (strain K12)

KEGG orthology group: K02752, PTS system, arbutin-, cellobiose-, and salicin-specific IIB component [EC: 2.7.1.69] K02753, PTS system, arbutin-, cellobiose-, and salicin-specific IIC component (inferred from 96% identity to enc:ECL_04054)

MetaCyc: 89% identical to beta-glucoside specific PTS enzyme IIBC component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-153A [EC: 2.7.1.199]

Predicted SEED Role

"PTS system, arbutin-, cellobiose-, and salicin-specific IIBC component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.199 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>EX28DRAFT_2806 Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific (Enterobacter asburiae PDN3)
MAKNYAALANDVISALGGKENIVAVTHCMTRLRFVLKDESLTDAARLKSISGVLGVVRND
NQCQVIIGNTVSQAYREVVSLLPTDLQPAVPEGPQKMTLRRIGSGILDALIGTMSPLIPA
IIGGSMVKLLAMILEMTGVLPKGAPTLTILTVIGDGAFFFLPLMVAASAAVKFKTNMSLA
IAIAGVLVHPSFIELMAKAAQGEHVEFAFIPVTAVKYTYTVIPALVMTWCLSYIERWVDR
ITPAVTKNFLKPMLIVLIAAPLAIVLIGPLGIWIGSAISALVYTIHGYLGWLSVAIMGAL
WPLLVMTGMHRVFTPTIIQTIAETGKEGMVMPSEIGANLSLGGSSLAVAWKTKNPELRQT
ALAAAASAIMAGISEPALYGVAVRLKRPLIASLISGFICGAVAGMAGLASHSMAAPGLFT
SVQFFDPANPMTIVWVFGVMGLAVVLSFVLTLLLGFEDIPVEDEAEKARTLQTAPVQNNA
AKA