Protein Info for EX28DRAFT_2791 in Enterobacter asburiae PDN3

Annotation: PTS system, glucitol/sorbitol-specific, IIC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 123 to 149 (27 residues), see Phobius details TIGR00821: PTS system, glucitol/sorbitol-specific, IIC component" amino acids 1 to 181 (181 residues), 370.5 bits, see alignment E=7.3e-116 PF03608: EII-GUT" amino acids 5 to 171 (167 residues), 254.2 bits, see alignment E=3.1e-80

Best Hits

Swiss-Prot: 96% identical to PTHC_ECOLI: PTS system glucitol/sorbitol-specific EIIC component (srlA) from Escherichia coli (strain K12)

KEGG orthology group: K02783, PTS system, glucitol/sorbitol-specific IIC component (inferred from 96% identity to ecw:EcE24377A_2986)

MetaCyc: 96% identical to sorbitol-specific PTS enzyme IIC2 component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-169 [EC: 2.7.1.198]; TRANS-RXN-156 [EC: 2.7.1.198, 2.7.1.197]

Predicted SEED Role

"PTS system, glucitol/sorbitol-specific IIC component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.197 or 2.7.1.198

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>EX28DRAFT_2791 PTS system, glucitol/sorbitol-specific, IIC component (Enterobacter asburiae PDN3)
MIETITHGAEWFIGLFQKGGEVFTGMVTGILPLLISLLVIMNALINFIGQQRIERFAQRC
AGNPLSRYLVLPFIGTFVFCNPMTLSLGRFMPEKYKPSYYAAASYSCHSMNGLFPHINPG
ELFVYLGIASGLTTLGLPLGPLAVSYLLVGLVTNFFRGWVTDLTTAIFEKKMGIQLEQKV
HLSGATA