Protein Info for EX28DRAFT_2790 in Enterobacter asburiae PDN3

Annotation: lytic murein transglycosylase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13406: SLT_2" amino acids 57 to 350 (294 residues), 303.7 bits, see alignment E=6.6e-95 TIGR02282: lytic murein transglycosylase B" amino acids 62 to 352 (291 residues), 410.5 bits, see alignment E=1.7e-127

Best Hits

Swiss-Prot: 87% identical to MLTB_ECOLI: Membrane-bound lytic murein transglycosylase B (mltB) from Escherichia coli (strain K12)

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 92% identity to ent:Ent638_3179)

MetaCyc: 87% identical to membrane-bound lytic murein transglycosylase B (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]; 4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>EX28DRAFT_2790 lytic murein transglycosylase B (Enterobacter asburiae PDN3)
MFKRRYAALLPALILLSACSSKPKTEAVQQTAGAPSGGFLLEPQHNMMQMGGDFANNPAA
EQFIDKMVSKHGFDRQQLHEILSQAKRLDYVLRLMDRQAPTAQVPSGPNGAWLRYRKQFI
TPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLS
FNYPRRAEYFSSELETFLLMARSEQDDPLDLKGSFAGAMGYGQFMPSSYKQYAVDFNGDG
HINLWDPVDAIGSVANYFKEHGWVPGGQVAVQANGEAFGLENGFKTKYSVAQLTAAGLTP
TQPLGNVDQVSLLRLDVGTGYQYWYGMPNFYTITRYNHSTHYAMAVWQLGLAVSQARVPA
ASPFSQ