Protein Info for EX28DRAFT_2787 in Enterobacter asburiae PDN3

Annotation: ABC-type metal ion transport system, periplasmic component/surface adhesin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF01297: ZnuA" amino acids 19 to 282 (264 residues), 294.7 bits, see alignment E=3.4e-92

Best Hits

Swiss-Prot: 36% identical to MNTA_LISIN: Manganese-binding lipoprotein MntA (mntA) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: K02077, zinc/manganese transport system substrate-binding protein (inferred from 94% identity to enc:ECL_04035)

Predicted SEED Role

"Zinc ABC transporter, periplasmic-binding protein ZnuA" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>EX28DRAFT_2787 ABC-type metal ion transport system, periplasmic component/surface adhesin (Enterobacter asburiae PDN3)
MALALGMMSHGVMAKTLNVVTSFSILGDITQEVGGDHVNVTTLVGPDGDPHTFEPSPKDS
AALSKADVVVVNGLGLEGWLDRLVKASGFKGQLVVASTGVKTHTLEEDGKTVTDPHAWNS
AANGALYAQNILNGLVKADPEDKAALEASGKTYIAQLSQLDNWAKTCFSQIPPAKRKVLT
SHDAFGYFSRAYGVTFMAPQGLSSESEASAAQVAEIINQIKADGVKTWFMENQLDPRLVK
QIASATGAQPGGELYPEALSAKGGVADTYVKAFRHNVHTLADSMK