Protein Info for EX28DRAFT_2766 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 328 (312 residues), 133.7 bits, see alignment E=7.6e-43 amino acids 218 to 385 (168 residues), 39.4 bits, see alignment E=3.8e-14 PF00083: Sugar_tr" amino acids 34 to 182 (149 residues), 48 bits, see alignment E=9.3e-17

Best Hits

Swiss-Prot: 87% identical to YGAY_ECOLI: Putative uncharacterized transporter YgaY (ygaY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to enc:ECL_04020)

Predicted SEED Role

"MFS permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>EX28DRAFT_2766 Arabinose efflux permease (Enterobacter asburiae PDN3)
MTKTTQGLSPALILLMSVATGLAVASNYYAQPLLDTIARAFNLSASSAGFIVTAAQLGYA
AGLLFLVPLGDMFERRMLIVSMTLLAAGGMLITASSQSLTMMIVGTALTGLFSVVAQILV
PLAATLASPEKRGKVVGTIMSGLLLGILLARTVAGLLASLGGWRTVYWVASVLMVIMALA
LWRGLPKVKQENHLNYPQLLASVFSLFTQDKLLRTRALLGCFTFANFSILWTSMAFLLAA
PPFNYSEGVIGLFGLAGAAGALGARPAGGLADKGKSHLTTSAGLILLLLSWAAIWYGHIS
VLALIVGILVLDLTVQGVHITNQTVIYRVKPEARNRLTAGYMTSYFIGGAAGSLISASAW
QHAGWSGVCAIGAIVATLNLLVWWRGYHRQDAIN