Protein Info for EX28DRAFT_2750 in Enterobacter asburiae PDN3

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF00126: HTH_1" amino acids 9 to 65 (57 residues), 64.4 bits, see alignment E=7.7e-22 PF03466: LysR_substrate" amino acids 91 to 281 (191 residues), 85.2 bits, see alignment E=4.2e-28

Best Hits

Swiss-Prot: 90% identical to YAHB_ECOLI: Uncharacterized HTH-type transcriptional regulator YahB (yahB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to ent:Ent638_3146)

Predicted SEED Role

"Putative HTH-type transcriptional regulator yahB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>EX28DRAFT_2750 Transcriptional regulator (Enterobacter asburiae PDN3)
MNSIFTEENLLAFTTAARFGSFSKAAAELGVTTSAISYTIKRMETGLDVVLFVRSTRSIE
LTESGFYFYRKATDLLNDFHAIKRGIDTISQGIEARVRICINQLLYTPRHTARLLQVLKK
QFPTCQITVTTEVYNGVWDSIINNQANIAIGAPDTLLDGGGIDYTEIGAIRWVFAIAPEH
PLAFTPEPIAESQLRLYPNIMVEDTAHTINKKVGWLLHGQEAILVPDFNTKCQCQILGEG
IGFLPEYMAREAVEAGLLVTRRINNPRQDSRMLLATQHAATGQVTRWIKQQFGPAGVLTD
IYSDLLWRA