Protein Info for EX28DRAFT_2740 in Enterobacter asburiae PDN3

Annotation: Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00155: Aminotran_1_2" amino acids 51 to 389 (339 residues), 133.5 bits, see alignment E=1.1e-42 PF12897: Asp_aminotransf" amino acids 139 to 387 (249 residues), 59.5 bits, see alignment E=2.8e-20

Best Hits

KEGG orthology group: None (inferred from 96% identity to enc:ECL_03989)

Predicted SEED Role

"Transcriptional regulator, GntR family domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>EX28DRAFT_2740 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs (Enterobacter asburiae PDN3)
MSVNKLASSAQGLQSSAIRELLKHSKMAGVISLGGGIPNPDLFDHEGLKIAADAVLSQHF
GEAFQYGLTEGVPGLREEIQRICEGRGIACKADDVVITSGSQQSLDVLARALINPGDTVV
VERPTYLAALQVFGLAQANFESVGTDGDGMKVDELEALAANKTIKAVYIVPTFGNPGGVT
LSEARRKQLVELSKRYDFVIIEDDPYSEINYTDEVFRPLIAHAKDIGNEENVVYTSTFSK
ILAPGTRVGWVLVPEWLKRAVVNLKQTTDLHTSTLSQLMTYEYLKTGRLPDQIKTIREAY
RQKYQTFATELESELGDVMSFHKPKGGMFLWANMKNGSNTTRWLEKTLSNGVVFVPGEFF
YCNEPDHSTLRMSFVTPTDEELKEAVQRLKKSL