Protein Info for EX28DRAFT_2734 in Enterobacter asburiae PDN3

Annotation: Multidrug resistance efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 72 to 102 (31 residues), 37.2 bits, see alignment (E = 3.9e-13) PF13437: HlyD_3" amino acids 248 to 347 (100 residues), 48.6 bits, see alignment E=2.5e-16

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 97% identity to enc:ECL_03983)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>EX28DRAFT_2734 Multidrug resistance efflux pump (Enterobacter asburiae PDN3)
MKISQRDVAAMDDLDNALDSESGYTGARRIVIFSLLMFVVLGVWAWFGVLDEVSTGSGKV
IPSSREQVLQSLDGGILTELNVHEGDQVQAGQVLARLDPTRSESNVGESAARYRASLASS
ARLYAEVNDLPLKFPPSLAKWPDLMADETRLYNSRRAQLEDTQRELRAALDLANKELAIT
QRLVKTGAASHVEVLRLQRQKSDLELKLTDVRSQYYVQAREALSKANAEVDMVSAILKGR
QDSVTRLTVKSPVRGIVKNIKVTTIGGVIPPNGELMEIVPVDDHLLIETRLSPRDIAFIH
PNQEALVKITAYDYAIYGGLHGVVETISPDTIQDEAKPEVFYYRVFIRTSQDYLVNKAGR
HFSIVPGMIATVDIKTGEKTVLDYLIKPFNRAKEALRER