Protein Info for EX28DRAFT_2732 in Enterobacter asburiae PDN3

Annotation: type I secretion outer membrane protein, TolC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 58 to 461 (404 residues), 346.2 bits, see alignment E=1.4e-107 PF02321: OEP" amino acids 67 to 241 (175 residues), 87.1 bits, see alignment E=6.6e-29 amino acids 271 to 437 (167 residues), 63.4 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: None (inferred from 94% identity to enc:ECL_03981)

Predicted SEED Role

"Type I secretion system, outer membrane component LapE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>EX28DRAFT_2732 type I secretion outer membrane protein, TolC family (Enterobacter asburiae PDN3)
MGMKMPHWWLSCCLISVPALCANPAAIINTGQLRETQELPSLNGRVAPAAGKAAPGSLQL
GDAVNRAVTWHPAISEAVGKLYEQSEEVDVAKSKYYPQINAGVDSGYSHDGDQNGFTPSL
VLSLSQMLYDFGKVASQVRAESAGVAQQQANVLVSIDTIAHDTAIAMVQVQTLQQMVDTA
KEQLDALSSIGSLTRQRNDEGATSLSDVVQTDARIEGARAQLMQYQASLDSARATLMSFL
GWNSLNAISNDFPQKLGRSCDIAEPDDRLVPAVLAAWAQANVAQANLDYADAQMTPTVSL
EPEVRHYMNDRYAGSETRDRTQYSAWVKVQMPLYQGGGLTARRNAAGHAVEAAQSSIQRT
RLDVRQKLLEARSQVMSLQSTLQIQGRQEALSARTRELYQQQYLDLGSRPLLDVLNAEQE
VYQARFTQQQTLGQLHQLQLNCLYNTGQLRHAFDLDNRTIQTVEIQP