Protein Info for EX28DRAFT_2729 in Enterobacter asburiae PDN3

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF07638: Sigma70_ECF" amino acids 19 to 180 (162 residues), 31.7 bits, see alignment E=3.5e-11 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 27 to 179 (153 residues), 63.6 bits, see alignment E=8.4e-22 PF22029: PhyR_sigma2" amino acids 31 to 85 (55 residues), 29.3 bits, see alignment E=1.8e-10 PF04542: Sigma70_r2" amino acids 33 to 95 (63 residues), 29.9 bits, see alignment E=9.7e-11 PF08281: Sigma70_r4_2" amino acids 125 to 177 (53 residues), 52.6 bits, see alignment E=7.4e-18 PF04545: Sigma70_r4" amino acids 133 to 177 (45 residues), 35.9 bits, see alignment 1.1e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 79% identity to pam:PANA_1604)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>EX28DRAFT_2729 RNA polymerase sigma factor, sigma-70 family (Enterobacter asburiae PDN3)
MTCRPPSTDIRNPDFLVEGKHIATSEVRQQLAAHLARLWRYGLVLSRNRDIAEELVQSTC
VRALERSSQYTPGTRIDRWLFAILHSIWISELRARHVRQGQGFVASDELLAPDTRQQDET
RLHYMKVMQRVNALPEAQRNAVFLVYVEGFTYQEAAETLAVPIGTVMSRLATARARLARS
ADALPPVKEKRS