Protein Info for EX28DRAFT_2722 in Enterobacter asburiae PDN3

Annotation: Oligoketide cyclase/lipid transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF10604: Polyketide_cyc2" amino acids 1 to 137 (137 residues), 42.8 bits, see alignment E=6.2e-15 PF03364: Polyketide_cyc" amino acids 10 to 135 (126 residues), 134.1 bits, see alignment E=3.3e-43

Best Hits

Swiss-Prot: 90% identical to PAST_ECOL6: Persistence and stress-resistance toxin PasT (pasT) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 92% identity to esc:Entcl_1103)

Predicted SEED Role

"Putative oligoketide cyclase/lipid transport protein, similarity with yeast ubiquinone-binding protein YOL008W"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>EX28DRAFT_2722 Oligoketide cyclase/lipid transport protein (Enterobacter asburiae PDN3)
MPQISRTALVPYSAEQMYQLVNDVQSYPEFIPGCTGSRVLESGPTQMTAAVDVSKAGISK
TFTTRNTLTSNQSILMHLVDGPFKTLMGGWKFTPLSADACRIEFQLDFEFTNKLIELAFG
RIFKELASNMVQAFTTRAKEVYSVA