Protein Info for EX28DRAFT_2716 in Enterobacter asburiae PDN3

Annotation: Molecular chaperone GrpE (heat shock protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01025: GrpE
  • amino acids 36 to 194 (159 residues), 160.6 bits, E=1.4e-51

Best Hits

Swiss-Prot: 91% identical to GRPE_ENT38: Protein GrpE (grpE) from Enterobacter sp. (strain 638)

KEGG orthology group: K03687, molecular chaperone GrpE (inferred from 99% identity to enc:ECL_03946)

MetaCyc: 88% identical to nucleotide exchange factor GrpE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Heat shock protein GrpE" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Protein Sequence (197 amino acids)

>EX28DRAFT_2716 Molecular chaperone GrpE (heat shock protein) (Enterobacter asburiae PDN3)
MSSKEQKTPEGQAPEEIITEQHDEVEAVEPDASAEQVDPRDEKIANLEAQLVEAQNRERD
GVLRIKAEMENLRRRTEQDVEKAHKFALEKFVNELLPVIDSLDRALEVADKANPDNAAMI
EGIELTLKSMLDVVRKFGVEVIADTDVPLDPNVHQAIAMVESEEVEAGKVLGVMQKGYTL
NGRTIRAAMVTVAKAKA