Protein Info for EX28DRAFT_2714 in Enterobacter asburiae PDN3

Annotation: ABC-type uncharacterized transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 61 to 285 (225 residues), 151.8 bits, see alignment E=1.1e-48

Best Hits

Swiss-Prot: 90% identical to YPJD_ECOL6: Inner membrane protein YpjD (ypjD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 99% identity to enc:ECL_03944)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>EX28DRAFT_2714 ABC-type uncharacterized transport system, permease component (Enterobacter asburiae PDN3)
MQRLEQASRNVILLLFLIKTTVDAYMPVFALIALVAYSVSLALIVPGLLQKNSGWRRMAI
LSAVIALISHAFALESRIIPGDGSVQNLSVLNVGSLVSLMICTVMTIVASKNRGWLLLPI
VYTFALINLALATFMPNEFITHLEATPGMLVHIGLSLFAYATLIIAALYAMQLAWIDYQL
KNKKLAFNHEMPPLMVIERKMFHITQVGVVLLTLTLCTGLFYMKNLFSVENIDKAVLSII
AWFVYIVLLWGHYHEGWRGRRVVWFNVAGAGILTLAYFGSRFIQQFAG