Protein Info for EX28DRAFT_2714 in Enterobacter asburiae PDN3

Annotation: ABC-type uncharacterized transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01578: Cytochrom_C_asm
  • amino acids 61 to 285 (225 residues), 151.7 bits, E=1.2e-48

Best Hits

Swiss-Prot: 90% identical to YPJD_ECOL6: Inner membrane protein YpjD (ypjD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 99% identity to enc:ECL_03944)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Protein Sequence (288 amino acids)

>EX28DRAFT_2714 ABC-type uncharacterized transport system, permease component (Enterobacter asburiae PDN3)
MQRLEQASRNVILLLFLIKTTVDAYMPVFALIALVAYSVSLALIVPGLLQKNSGWRRMAI
LSAVIALISHAFALESRIIPGDGSVQNLSVLNVGSLVSLMICTVMTIVASKNRGWLLLPI
VYTFALINLALATFMPNEFITHLEATPGMLVHIGLSLFAYATLIIAALYAMQLAWIDYQL
KNKKLAFNHEMPPLMVIERKMFHITQVGVVLLTLTLCTGLFYMKNLFSVENIDKAVLSII
AWFVYIVLLWGHYHEGWRGRRVVWFNVAGAGILTLAYFGSRFIQQFAG