Protein Info for EX28DRAFT_2712 in Enterobacter asburiae PDN3

Annotation: SSU ribosomal protein S16P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 TIGR00002: ribosomal protein bS16" amino acids 22 to 99 (78 residues), 94.1 bits, see alignment E=2e-31 PF00886: Ribosomal_S16" amino acids 28 to 88 (61 residues), 89.7 bits, see alignment E=4.8e-30

Best Hits

Swiss-Prot: 96% identical to RS16_KLEP7: 30S ribosomal protein S16 (rpsP) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02959, small subunit ribosomal protein S16 (inferred from 97% identity to kpu:KP1_4187)

MetaCyc: 88% identical to 30S ribosomal subunit protein S16 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S16p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>EX28DRAFT_2712 SSU ribosomal protein S16P (Enterobacter asburiae PDN3)
MTPGSVPRWGPVVLFTQEDVMVTIRLARHGAKKRPFYQVVVTDSRNARNGRFIERVGFFN
PLAAGAEEETRLDLDRIAHWVGQGATVSDRVATLIKAANKAA