Protein Info for EX28DRAFT_2711 in Enterobacter asburiae PDN3

Annotation: 16S rRNA processing protein RimM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 TIGR02273: 16S rRNA processing protein RimM" amino acids 10 to 178 (169 residues), 209.4 bits, see alignment E=1.1e-66 PF01782: RimM" amino acids 12 to 92 (81 residues), 98.5 bits, see alignment E=3.3e-32 PF05239: PRC" amino acids 100 to 173 (74 residues), 42.2 bits, see alignment E=9.7e-15 PF24986: PRC_RimM" amino acids 104 to 177 (74 residues), 44.9 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 94% identical to RIMM_ENT38: Ribosome maturation factor RimM (rimM) from Enterobacter sp. (strain 638)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 98% identity to enc:ECL_03941)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>EX28DRAFT_2711 16S rRNA processing protein RimM (Enterobacter asburiae PDN3)
MSNKAPVEPIVLGKMGSCYGIRGWLRVFSSTEDADSIFDYQPWFIQKGGKWEEVELESWR
HHNQDIIIKLKGVDDRDAANALTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYSL
GKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTQTIEVDWDPGF