Protein Info for EX28DRAFT_2703 in Enterobacter asburiae PDN3

Annotation: Protein of unknown function (DUF2799)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF10973: DUF2799" amino acids 32 to 114 (83 residues), 67.4 bits, see alignment E=6.2e-23

Best Hits

Swiss-Prot: 50% identical to YFIL_ECOLI: Uncharacterized protein YfiL (yfiL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to enc:ECL_03933)

Predicted SEED Role

"FIG00626550: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (124 amino acids)

>EX28DRAFT_2703 Protein of unknown function (DUF2799) (Enterobacter asburiae PDN3)
MRPIALALLSLFLTGCQINPYTFQPDWTSPSWFDAGKEDAMNGLPVKDNQALADSFNDTH
VDRSEYLRGYADGQKKVCEEGFIHAWGLAGKSFPASCDTAENAAKLRASWQQGMDESMRS
SRLN