Protein Info for EX28DRAFT_2696 in Enterobacter asburiae PDN3

Annotation: Beta-barrel assembly machine subunit BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 5 to 243 (239 residues), 292.2 bits, see alignment E=1.4e-91 PF13512: TPR_18" amino acids 24 to 167 (144 residues), 234.2 bits, see alignment E=9.1e-74 PF13525: YfiO" amino acids 28 to 236 (209 residues), 287.7 bits, see alignment E=8.2e-90

Best Hits

Swiss-Prot: 94% identical to BAMD_ECO57: Outer membrane protein assembly factor BamD (bamD) from Escherichia coli O157:H7

KEGG orthology group: K05807, putative lipoprotein (inferred from 99% identity to ent:Ent638_3075)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>EX28DRAFT_2696 Beta-barrel assembly machine subunit BamD (Enterobacter asburiae PDN3)
MTRMKYLVAAATLSLALVGCSGSNEQVPDNPPNEIYATAQQKLQDGNWKQAITQLEALDN
RYPFGPYSQQVQLDLIYAYYKNADLPLAQATIDRFMRLNPTHPNIDYVMYMRGLTNMALD
DSALQGFFGVDRSDRDPQHARDAFNDFSKLVRGYPNSQYVTDATKRLVFLKDRLAKYEYS
VAEYYTRRGAWVAVVNRVEGMLRDYPDTQATRDGLKLMENAYRQMQMTAQAEKVAKIIAA
NSSNT